PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00150671001
Common NameGSBRNA2T00150671001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 317aa    MW: 34185 Da    PI: 9.4179
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00150671001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.75.1e-383392362
               zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                           +lkcprCds+ntkfCyynnyslsqPryfCkaC+ryWt+GG+lrnvPvGg+ rknk+++
  GSBRNA2T00150671001 33 PPQLKCPRCDSSNTKFCYYNNYSLSQPRYFCKACKRYWTQGGTLRNVPVGGSYRKNKRVK 92
                         5689*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.5E-333590IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-253690IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7233690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MPMISSTNTN PLASMQSKNM IVAPSHQQQQ QQPPQLKCPR CDSSNTKFCY YNNYSLSQPR  60
YFCKACKRYW TQGGTLRNVP VGGSYRKNKR VKRPATTTVA STASTTTSSS PNNPHHQISQ  120
FSSVNHHPLF YGLSDHVSSC NNLPMMVPSR FSDSSKTSSS SGLESEFISS GFSGLGALGL  180
GLPHYLNHDH TINSSFLNNS TTNKPFLLSG LFGSSVSSSS STLLQHPHKT INNGGEMMGQ  240
SHIRTLAPLP HVGGNTDDMN KEGKLDQISG NINGFMSSSS LNPSNNNNIW NNASVVNGAC  300
LDLTNNDVGS FLTSLI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00150671001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013656945.10.0PREDICTED: dof zinc finger protein DOF1.4-like
SwissprotQ9FZA41e-138DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBLA0A078DMF70.0A0A078DMF7_BRANA; BnaA08g18420D protein
STRINGBra010884.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-101Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]